CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Crispy Rice Bowl Bibimbap

Warm rice topped with quick-sautéed veggies, a runny egg, and gochujang-sesame sauce — all made in one skillet. Toss it together and taste the umami.

Total time
20 min
Servings
2
Calories
520
Protein
12g
20-Min Crispy Rice Bowl Bibimbap
comfortquickkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups cooked rice (white or brown)
  • 3 tbsp gochujang (Korean red chili paste)
  • 2 tbsp sesame oil
  • 2 cups mixed vegetables (spinach, mushrooms, shredded carrot, zucchini)
  • 2 whole eggs
  • 2 stalks scallions, sliced (white + green parts separated)
  • 1 tbsp sesame seeds (white or black)

Instructions

  1. 1

    Mix gochujang with 1 tbsp sesame oil, 1 tbsp water, and 1 tsp sugar until smooth.

  2. 2

    Heat 1 tbsp sesame oil in a large skillet over medium-high until shimmering.

  3. 3

    Add vegetables (white parts of scallions first), stirring occasionally, until tender and lightly browned, about 5 minutes.

  4. 4

    Push vegetables to the side of the skillet; add rice and warm through, tossing gently, about 2 minutes.

  5. 5

    Push everything to the edge; crack eggs into the center and cook until whites set but yolks still jiggle, about 3 minutes.

  6. 6

    Top with gochujang sauce, green scallions, and sesame seeds; toss everything together and serve immediately.

Tools you’ll need

  • 12-inch nonstick or cast iron skillet
  • small bowl
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.