Crispy Pretzel Bites
Soft, chewy pretzel pieces tossed in melted butter and coarse salt, then air-fried until golden and crispy on the outside. Ready in 10 minutes with zero rising time required.
- Total time
- 10 min
- Servings
- 2
- Calories
- 185
- Protein
- 3g

casualquickamericanvegetariancrispychewysnackweeknight
Ingredients
- 8 oz frozen pretzel bites
- 2 tbsp butter
- ½ tsp coarse salt
- ¼ tsp garlic powder
- black pepper
Instructions
- 1
Preheat air fryer to 380°F for 2 minutes.
- 2
Melt butter in a small bowl and stir in garlic powder, salt, and pepper.
- 3
Toss frozen pretzel bites with butter mixture until evenly coated.
- 4
Spread in air fryer basket and cook 6–8 minutes until golden brown.
- 5
Pour onto paper towels. Serve warm.
Tools you’ll need
- air fryer
- small bowl
- spoon
- paper towels
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



