CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Potato Pancakes

Shredded potato and onion bound with egg, pan-fried until golden and crispy. Serve with sour cream or applesauce for a classic German comfort dinner.

Total time
18 min
Servings
2
Calories
280
Protein
8g
Crispy Potato Pancakes
comfortcozygermanvegetarianeggscrispytenderweeknight

Ingredients

  • 1 lb russet potatoes, unpeeled
  • ½ medium yellow onion
  • 2 large eggs
  • 2 tbsp all-purpose flour
  • ½ cup sour cream or applesauce
  • 3 tbsp neutral cooking oil

Instructions

  1. 1

    Grate potatoes and onion on the large holes of a box grater into a bowl. Squeeze firmly with paper towels to remove excess moisture.

  2. 2

    Add eggs and flour to the potato mixture. Stir vigorously until sticky and cohesive, about 30 seconds.

  3. 3

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds. Working quickly, drop heaping spoonfuls of potato mixture onto the hot skillet.

  4. 4

    Flatten each pancake gently with a spatula. Fry 3–4 minutes per side until deep golden brown and crispy on the edges.

  5. 5

    Transfer to a paper-towel-lined plate. Sprinkle with salt and pepper. Serve hot with sour cream or applesauce.

Tools you’ll need

  • box grater
  • large mixing bowl
  • paper towels
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.