CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Potato Gratin with Baked Chicken

Creamy, golden potato gratin baked in one pan alongside chicken breast. A warm, satisfying dinner that feels fancy but comes together in under 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
38g
Crispy Potato Gratin with Baked Chicken
comfortcozyfrenchgluten-freechickencreamycrispytender

Ingredients

  • 2 pieces (about 6 oz each) chicken breast
  • 1 lb, thinly sliced russet potato
  • 1 cup gruyère or emmental cheese, grated
  • ¾ cup heavy cream
  • 1 clove garlic clove, minced
  • 1 pinch, to taste salt and black pepper

Instructions

  1. 1

    Preheat oven to 425°F. Pat chicken dry and season all over with salt and pepper.

  2. 2

    Arrange potato slices in a buttered 10-inch baking dish, overlapping slightly.

  3. 3

    Whisk cream, garlic, and half the cheese in a bowl. Pour over potatoes.

  4. 4

    Nestle chicken breasts on top of potatoes. Sprinkle remaining cheese over chicken.

  5. 5

    Bake until chicken is cooked through (165°F internal temp) and potatoes are tender and golden, 16–18 minutes.

  6. 6

    Rest 2 minutes. Serve straight from the baking dish.

Tools you’ll need

  • 10-inch baking dish
  • instant-read thermometer
  • whisk
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.