CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Potato & Egg Tacos

Golden hash brown potatoes stuffed into warm tortillas with scrambled eggs and topped with cheese and salsa. Tex-Mex comfort food ready in 15 minutes, no meat required.

Total time
15 min
Servings
2
Calories
395
Protein
14g
Crispy Potato & Egg Tacos
comfortcasualtex-mexvegetarianeggscrispycreamyweeknight

Ingredients

  • 2 medium russet potatoes, shredded
  • 4 whole eggs
  • 4 whole corn tortillas
  • ½ cup shredded cheddar cheese
  • ½ cup salsa
  • 2 tbsp olive oil

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium-high heat until shimmering, ~60 seconds.

  2. 2

    Add shredded potatoes, press flat, and cook without stirring for 4 minutes until golden on the bottom.

  3. 3

    Stir potatoes, break up any clumps, and cook for 2 more minutes until crispy and cooked through.

  4. 4

    Push potatoes to the side; add remaining 1 tbsp oil to the empty side of the pan.

  5. 5

    Crack eggs into the oiled side, add a pinch of salt and pepper, and stir until scrambled and set, ~3 minutes.

  6. 6

    Warm tortillas directly over a gas flame or in a dry skillet for 15 seconds per side until pliable.

  7. 7

    Fill each tortilla with potatoes, scrambled eggs, and cheese.

  8. 8

    Top with salsa and serve immediately.

Tools you’ll need

  • 12-inch nonstick skillet
  • spatula
  • paper towels or clean towel

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.