CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Pork & Rice Broken

Vietnamese com tam suon — crispy pork chops seared until golden, served over broken rice with a tangy lime-fish sauce drizzle. Comes together in under 20 minutes with minimal fuss.

Total time
20 min
Servings
2
Calories
520
Protein
32g
Crispy Pork & Rice Broken
satisfyingcasualvietnameseporkcrispytenderweeknightmain-dish

Ingredients

  • 1 cup, cooked jasmine rice (or short-grain white rice)
  • 2 pieces (about 5 oz each) pork chops, boneless
  • 2 tbsp fish sauce
  • 1 whole (juiced) lime
  • 1 whole shallot, thinly sliced
  • 2 tbsp Vietnamese pâté (optional but traditional)
  • ¼ cup fresh herbs (cilantro or mint, chopped)

Instructions

  1. 1

    If using uncooked rice, boil in salted water until tender, ~15 min, then drain. If precooked, warm it gently.

  2. 2

    Pat pork chops dry with paper towels. Season both sides generously with salt and black pepper.

  3. 3

    Heat oil in a large skillet over medium-high heat until shimmering, ~90 seconds. Sear pork 3–4 minutes per side until golden brown and cooked through.

  4. 4

    Transfer pork to a cutting board. Stir the shallot into the hot skillet for 30 seconds until fragrant, then remove from heat.

  5. 5

    Whisk fish sauce and lime juice together in a small bowl. Spread rice on a plate, top with pork, and drizzle with fish sauce mixture.

  6. 6

    Scatter shallots, pâté (if using), and fresh herbs over the top. Serve immediately.

Tools you’ll need

  • pot (for cooking rice if not precooked)
  • 12-inch skillet
  • paper towels
  • cutting board
  • small mixing bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.