Custrd is out on the App Store — Download it free →
Back to recipes

15-Min Crispy Pork Carnitas with Rice & Beans

Rotisserie pork shredded and crisped in a skillet with cumin and lime, served over rice and beans with warm tortillas. Dinner on the table in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
38g
15-Min Crispy Pork Carnitas with Rice & Beans
satisfyingcasualmexicanporkcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, about 1 minute.

  2. Step 2

    Add shredded pork and cumin, stir to coat, then spread in a single layer.

  3. Step 3

    Cook without stirring for 4 minutes until edges crisp and brown. Stir once and cook 2 minutes more.

  4. Step 4

    Warm rice and beans in a small pot over low heat while pork finishes, about 3 minutes.

  5. Step 5

    Warm tortillas in a dry skillet for 30 seconds per side until pliable.

  6. Step 6

    Divide rice and beans between two plates, top with crispy pork, squeeze lime over, serve with warm tortillas.

Tools you’ll need

  • 12-inch skillet
  • small pot
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.