CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pita Fattoush with Sumac Dressing

Tangy, crunchy Lebanese salad loaded with fresh greens, tomatoes, and crispy pita chips, all tossed with a bright lemon-sumac vinaigrette. Ready in 15 minutes.

Total time
15 min
Servings
2
Calories
320
Protein
8g
Crispy Pita Fattoush with Sumac Dressing
lightfreshmiddle-easternvegetarianvegancrispycrunchyweeknight

Ingredients

  • 2 pieces (6-inch) pita bread
  • 4 cups (chopped) romaine lettuce
  • 2 medium (diced) tomatoes
  • 1 medium (diced) cucumber
  • 4 small (thinly sliced) radishes
  • 3 tbsp lemon juice
  • 1 tbsp sumac

Instructions

  1. 1

    Tear pita into bite-sized pieces. Spread on a baking sheet and toast under a broiler or in a 400°F oven for 2 minutes per side until golden and crispy.

  2. 2

    While pita toasts, chop romaine, tomatoes, cucumber, and radishes into a large bowl.

  3. 3

    Whisk lemon juice with 3 tablespoons olive oil, 1 tablespoon sumac, and a pinch of salt and pepper.

  4. 4

    Toss the greens and vegetables with the dressing until everything is coated.

  5. 5

    Add warm pita chips and toss gently to combine. Serve immediately while pita is still crispy.

Tools you’ll need

  • baking sheet
  • broiler or oven
  • large mixing bowl
  • whisk
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.