Crispy Pesto Mozzarella Zucchini Sandwich
Thin zucchini slices grilled until golden and piled onto bread with melted mozzarella and pesto. A quick, cheesy, veggie-loaded sandwich that's ready in 15 minutes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 310
- Protein
- 12g
quicksimpleamericanvegetariancheesecrispymeltyweeknight
Ingredients
- 1 medium zucchini
- 2 slices bread
- 2 oz mozzarella cheese
- 2 tbsp pesto
Instructions
- 1
Slice the zucchini lengthwise into 1/4-inch-thick planks.
- 2
Heat oil in a skillet over medium-high until shimmering, about 90 seconds.
- 3
Pan-fry zucchini 2 minutes per side until golden and tender, working in batches if needed.
- 4
Spread pesto on both bread slices, then layer zucchini and mozzarella between them.
- 5
Wipe the skillet, return it to medium heat, and pan-fry sandwich 2 minutes per side until bread crisps and cheese melts.
Tools you’ll need
- cutting board
- knife
- 12-inch skillet
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
