CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pesto Mozzarella Melt

Fresh mozzarella and basil pesto melted between buttery croissant halves, toasted until the edges crisp and cheese oozes out. Ready in 10 minutes—pure Italian sandwich bliss.

Total time
10 min
Servings
2
Calories
580
Protein
22g
Crispy Pesto Mozzarella Melt
casualquickitalianvegetariancheesecrispymeltygooey

Ingredients

  • 2 whole croissants, large
  • 6 oz fresh mozzarella
  • 3 tbsp basil pesto
  • 2 tbsp butter
  • 1 small (optional) tomato, ripe

Instructions

  1. 1

    Split the croissants horizontally and spread 1.5 tbsp pesto on each bottom half.

  2. 2

    Tear mozzarella into thick pieces and layer over pesto on both halves, dividing evenly.

  3. 3

    Top with croissant lids. Spread 0.5 tbsp butter on the outside of each top and bottom.

  4. 4

    Heat a skillet over medium-high until butter foams, ~90 seconds.

  5. 5

    Place sandwiches flat side down and cook until golden and crispy, 2–3 minutes per side.

  6. 6

    Slice in half if desired. Serve hot while cheese is still melty.

Tools you’ll need

  • cutting board
  • knife
  • 12-inch skillet or griddle
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.