CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pane Carasau with Tomato & Herbs

Thin, crackly Sardinian flatbread brushed with olive oil and baked until golden, topped with fresh tomato, garlic, and basil. Ready in 15 minutes, pure vegan comfort.

Total time
15 min
Servings
2
Calories
280
Protein
6g
Crispy Pane Carasau with Tomato & Herbs
simplerusticitalianveganvegetariancrispyflakyweeknight

Ingredients

  • 4 sheets pane carasau (Sardinian flatbread)
  • 3 tbsp olive oil
  • 2 medium ripe tomatoes
  • 2 cloves garlic
  • 8 leaves fresh basil
  • 1 pinch salt and pepper

Instructions

  1. 1

    Preheat oven to 400°F. Arrange pane carasau sheets on a sheet pan in a single layer.

  2. 2

    Brush both sides of each sheet with olive oil. Season lightly with salt and pepper.

  3. 3

    Bake until golden and crispy at the edges, 5–6 minutes. Remove and cool for 1 minute.

  4. 4

    Dice tomatoes. Mince garlic and stir together with remaining olive oil, salt, and pepper.

  5. 5

    Spoon tomato mixture evenly over warm pane carasau. Tear basil and scatter over top.

  6. 6

    Serve immediately while bread is still crispy.

Tools you’ll need

  • sheet pan
  • oven
  • knife
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.