CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pan-Fried Wontons

Golden, crispy wontons with a savory pork and cabbage filling, finished in minutes with a sweet and tangy dipping sauce. Perfect as an appetizer or light dinner.

Total time
35 min
Servings
4
Calories
285
Protein
12g
Crispy Pan-Fried Wontons
casualsatisfyingchinesecrispytenderweeknightappetizerappetizer

Ingredients

  • ½ lb ground pork
  • 24 count wonton wrappers
  • 1 cup cabbage, finely chopped
  • 3 tbsp soy sauce
  • 2 tbsp rice vinegar
  • 1 tbsp sesame oil
  • 2 cloves garlic, minced
  • 1 tbsp honey

Instructions

  1. 1

    Cook ground pork in a skillet over medium-high heat, breaking up with a spoon, until no pink remains, ~5 minutes.

  2. 2

    Add chopped cabbage and minced garlic to the pork. Cook, stirring, for 2 minutes until fragrant.

  3. 3

    Stir in 1 tbsp soy sauce and 1 tbsp sesame oil. Remove from heat and let cool 5 minutes.

  4. 4

    Whisk together remaining 2 tbsp soy sauce, rice vinegar, and honey in a small bowl for dipping sauce.

  5. 5

    Place 1 tbsp filling in the center of a wonton wrapper. Wet edges with water.

  6. 6

    Fold wrapper into a triangle, pressing edges to seal. Then bring two corners together and press to seal into a pouch.

  7. 7

    Repeat with remaining wrappers and filling until you have 24 wontons.

  8. 8

    Heat 2 tbsp oil in a large skillet over medium heat until it shimmers, ~1 minute.

  9. 9

    Working in batches, pan-fry wontons 2-3 minutes per side until golden brown and crispy. Don't crowd the pan.

  10. 10

    Transfer finished wontons to a paper towel-lined plate. Serve hot with dipping sauce.

Tools you’ll need

  • large skillet
  • small mixing bowl
  • whisk
  • spoon
  • paper towels
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.