CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Mak Guksu

Chewy Korean noodles tossed with crispy potato, zucchini, and a savory soy-garlic sauce. Ready in under 25 minutes and hits every textural note.

Total time
25 min
Servings
2
Calories
420
Protein
9g
Crispy Mak Guksu
comfortsatisfyingkoreanvegetarianvegetarianchewycrispyweeknight

Ingredients

  • 200 g mak guksu noodles (or ramen)
  • 1 medium potato, peeled
  • 1 small zucchini
  • 3 tbsp soy sauce
  • 1 tbsp sesame oil
  • 2 cloves garlic, minced
  • 3 stalks scallions, sliced

Instructions

  1. 1

    Cut potato into thin matchsticks. Cut zucchini into thin matchsticks or use a vegetable peeler for ribbons.

  2. 2

    Boil salted water in a large skillet or shallow pot. Add noodles and cook until just tender, about 4 minutes, then drain, reserving 1/4 cup pasta water.

  3. 3

    Return empty skillet to high heat. Add 2 tbsp oil. When it shimmers, add potato in a single layer and don't stir for 3 minutes until golden, then flip and crisp the other side, 2 minutes more.

  4. 4

    Push potato to the side. Add zucchini to the empty space, let it sear 2 minutes without stirring until lightly colored.

  5. 5

    Stir soy sauce, sesame oil, minced garlic, and reserved pasta water together. Pour over vegetables and noodles, toss gently to coat for 1 minute until glossy.

  6. 6

    Slide onto a plate. Top with scallions. Serve hot.

Tools you’ll need

  • large skillet or shallow 3-quart pot with lid
  • wooden spoon or tongs
  • vegetable peeler or sharp knife
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.