CookSnap is coming soon — Join the waitlist →

Crispy Lemon Chicken Quinoa Bowl

Seared chicken thighs over fluffy quinoa with cucumber, tomato, and feta, dressed in a bright lemon-garlic sauce. Ready in 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
42g
Crispy Lemon Chicken Quinoa Bowl
freshhealthygreekchickencrispytendercreamyweeknight

Ingredients

  • 1 lb boneless, skinless chicken thighs
  • 1 cup quinoa
  • 1 large cucumber
  • 1.5 cups cherry tomatoes
  • ½ cup crumbled feta cheese
  • 1 whole (juiced + zested) lemon
  • ½ cup kalamata olives, pitted

Instructions

  1. 1

    Bring 2 cups salted water to boil in a medium pot. Stir in quinoa, reduce heat, cover, and simmer until water absorbs, ~15 minutes.

  2. 2

    While quinoa cooks, pat chicken thighs dry. Season all over with salt and pepper.

  3. 3

    Heat 1 tbsp oil in a large skillet over medium-high. Sear chicken 6–7 minutes per side until skin crisps and center reaches 165°F.

  4. 4

    Chop cucumber into half-moons. Halve cherry tomatoes. Slice cooked chicken into strips.

  5. 5

    Whisk lemon juice, zest, 2 tbsp oil, and 1 minced garlic clove. Season with salt and pepper.

  6. 6

    Divide quinoa between bowls. Top with chicken, cucumber, tomatoes, olives, and feta. Drizzle with lemon dressing.

Tools you’ll need

  • medium pot with lid
  • large skillet
  • cutting board
  • knife
  • small bowl for whisking
  • meat thermometer (optional but recommended)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.