CookSnap is coming soon — Join the waitlist →

Crispy Künefe with Hot Honey & Pistachios

Shredded phyllo crisped in butter until golden, layered with stretchy cheese, then drowned in warm honey and topped with crushed pistachios. Salty, sweet, crunchy, addictive—ready in under 15 minutes.

Total time
12 min
Servings
2
Calories
520
Protein
12g
Crispy Künefe with Hot Honey & Pistachios
indulgentdecadentturkishmiddle-easternvegetariancheesecrispygooey

Ingredients

  • 4 tbsp unsalted butter
  • 1.5 cups shredded phyllo dough (kataifi)
  • 1 cup mozzarella cheese, shredded
  • ½ cup honey
  • ¼ cup roasted salted pistachios, crushed
  • 1 tbsp lemon juice
  • ¼ tsp vanilla extract

Instructions

  1. 1

    Heat butter in a 10-inch nonstick skillet over medium-high until foaming, ~90 seconds.

  2. 2

    Add shredded phyllo in a loose nest, pressing gently to form a round cake. Cook without stirring until golden brown, ~4 minutes.

  3. 3

    Scatter mozzarella evenly over the phyllo, cover with foil, and cook until cheese melts, ~2 minutes.

  4. 4

    Warm honey with lemon juice and vanilla in a small bowl. Pour over the künefe just before serving.

  5. 5

    Slide onto a plate, top with crushed pistachios, and serve warm.

Tools you’ll need

  • 10-inch nonstick skillet
  • small bowl
  • foil or lid
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.