CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Herb & Feta Stuffed Peppers

Sweet roasted peppers packed with herby chickpeas, crispy breadcrumbs, and tangy feta. Ready in under 25 minutes—no long braise needed.

Total time
25 min
Servings
4
Calories
285
Protein
11g
Crispy Herb & Feta Stuffed Peppers
comfortwholesomemediterraneanvegetarianchickpeascheesecrispytender

Ingredients

  • 4 whole bell peppers (red or yellow), halved lengthwise and seeded
  • 1.5 cups canned chickpeas, drained and rinsed
  • ¾ cup feta cheese, crumbled
  • ½ cup panko breadcrumbs
  • ¼ cup red onion, minced
  • 3 tbsp fresh herbs (dill, oregano, or parsley), chopped
  • ½ whole lemon

Instructions

  1. 1

    Arrange pepper halves cut-side up on a sheet pan. Drizzle with olive oil, salt, and pepper.

  2. 2

    Roast peppers in a 425°F oven for 10 minutes until they soften slightly around the edges.

  3. 3

    While peppers roast, toss chickpeas, feta, breadcrumbs, red onion, and fresh herbs in a bowl.

  4. 4

    Squeeze lemon juice over the filling. Stir and taste; adjust salt and pepper as needed.

  5. 5

    Divide filling evenly among pepper halves, packing gently so breadcrumbs stay visible on top.

  6. 6

    Return to oven and roast 10 minutes more until breadcrumbs turn golden and peppers are tender.

Tools you’ll need

  • sheet pan
  • medium mixing bowl
  • oven (425°F)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.