CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Grissini with Whipped Ricotta & Greens

Thin, snappy breadsticks brushed with olive oil and salt, served alongside creamy whipped ricotta dip and peppery microgreens. Ready in 20 minutes—perfect as an appetizer or light dinner.

Total time
20 min
Servings
2
Calories
385
Protein
12g
Crispy Grissini with Whipped Ricotta & Greens
casualsimpleitalianvegetariancheesecrispycreamyweeknight

Ingredients

  • 100 g store-bought grissini (thin breadsticks)
  • ¾ cup whole milk ricotta
  • ½ whole lemon
  • 1 cup fresh microgreens (or arugula)
  • 4 slices sliced baguette
  • 3 tbsp olive oil (divided)

Instructions

  1. 1

    Heat oven to 400°F. Lightly brush grissini with 1 tbsp olive oil and a pinch of salt.

  2. 2

    Spread on a sheet pan and bake until deeply golden and crispy, 8–10 minutes.

  3. 3

    Whisk ricotta with juice from half a lemon, salt, and pepper until light and airy.

  4. 4

    Toss microgreens with remaining 2 tbsp olive oil, a squeeze of lemon, salt, and pepper.

  5. 5

    Transfer grissini to a board. Dollop ricotta on the side, pile greens on top, and arrange baguette slices nearby.

  6. 6

    Serve immediately while grissini are still warm and crispy.

Tools you’ll need

  • oven
  • sheet pan
  • whisk
  • small bowl
  • large cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.