CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Grilled Veggie Hummus Wrap

Warm tortilla stuffed with creamy hummus, charred vegetables, and fresh greens, pressed until golden and served with a zingy tahini dip. A Mediterranean weeknight wrap that tastes like it came from a café.

Total time
18 min
Servings
2
Calories
385
Protein
12g
Crispy Grilled Veggie Hummus Wrap
freshquickcasualmediterraneanvegetarianveganchickpeascrispy

Ingredients

  • 2 count large flour tortillas
  • ½ cup hummus
  • 1 medium zucchini
  • 1 large bell pepper (any color)
  • ¼ count red onion
  • 1 cup fresh spinach or arugula
  • 3 tbsp tahini
  • 1 count lemon (juiced + zest)

Instructions

  1. 1

    Slice zucchini lengthwise into 1/4-inch planks. Slice bell pepper into wide strips. Thinly slice red onion.

  2. 2

    Heat a skillet over medium-high until it shimmers, about 2 minutes. Brush vegetables lightly with oil and salt.

  3. 3

    Grill vegetables in batches 2–3 minutes per side until charred and tender. Transfer to a plate.

  4. 4

    Spread hummus on the inside of each tortilla. Layer with greens, then grilled vegetables.

  5. 5

    Roll each tortilla tightly. Wipe the skillet and place wraps seam-side down. Cook 90 seconds per side until golden.

  6. 6

    Whisk tahini, lemon juice, lemon zest, and 2 tbsp water until smooth. Serve wraps with dipping sauce and side salad.

Tools you’ll need

  • 12-inch skillet or griddle
  • cutting board
  • chef's knife
  • small bowl for tahini sauce
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.