CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Gion Fish with Broccoli

Golden-fried whole fish with a shatteringly crispy exterior and tender flesh, served alongside steamed broccoli. A Vietnamese restaurant classic that comes together in under 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
45g
Crispy Gion Fish with Broccoli
satisfyingsimplevietnamesefishcrispytenderflakyweeknight

Ingredients

  • 2 pieces (8 oz each) whole fish (sea bass, snapper, or mackerel, cleaned and scaled)
  • 2 cups broccoli florets
  • 2 tbsp fish sauce
  • 1 whole (juiced) lime
  • 3 cloves garlic cloves, minced
  • 2 cups neutral cooking oil (for frying)

Instructions

  1. 1

    Bring a pot of salted water to a boil. Add broccoli and steam until tender-crisp, about 5 minutes. Drain and set aside.

  2. 2

    Pat fish dry inside and out with paper towels. Score the skin diagonally 3 times on each side. Season generously with salt.

  3. 3

    Heat oil in a deep skillet or wok to 350°F (use a thermometer). Working with one fish at a time, carefully slide it into the hot oil.

  4. 4

    Fry 5–6 minutes per side without moving, until skin is deep golden and crispy. Use a slotted spoon to flip gently once.

  5. 5

    Whisk together fish sauce, lime juice, minced garlic, and 2 tbsp water. Pour over the fish and broccoli on a serving plate.

  6. 6

    Serve immediately while the fish is still crispy.

Tools you’ll need

  • large pot (for steaming broccoli)
  • deep skillet or wok (12-inch minimum)
  • instant-read thermometer
  • slotted spoon
  • paper towels
  • small bowl (for dipping sauce)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.