CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy General Tso Chicken & Fried Rice Bowl

Glossy, crispy chicken in a sweet-spicy General Tso sauce, served over quick fried rice with fresh cucumber and tomato on the side. Ready in 20 minutes.

Total time
20 min
Servings
2
Calories
485
Protein
32g
Crispy General Tso Chicken & Fried Rice Bowl
satisfyingquickamericanchickencrispytenderweeknightbowl

Ingredients

  • 1 lb chicken breast, cut into 1-inch cubes
  • 3 tbsp soy sauce
  • 2 tbsp rice vinegar
  • 2 tbsp brown sugar
  • ½ tsp red pepper flakes
  • 2 cups cooked rice (white or jasmine)
  • 1 of each cucumber, sliced + tomato, sliced (for serving)

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. 2

    Add chicken and cook, stirring occasionally, until golden and cooked through, 6–7 minutes.

  3. 3

    Whisk soy sauce, vinegar, sugar, and red pepper flakes together, then pour over chicken.

  4. 4

    Stir and cook until sauce becomes glossy and coats the chicken, about 2 minutes.

  5. 5

    Push chicken to one side and add 2 cups cooked rice to the pan, stirring to warm and lightly toast, 2 minutes.

  6. 6

    Divide rice into bowls, top with crispy chicken and sauce, and serve with sliced cucumber and tomato on the side.

Tools you’ll need

  • 12-inch skillet
  • whisk
  • wooden spoon or spatula
  • measuring spoons
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.