CookSnap is coming soon — Join the waitlist →

Crispy Fish Tacos with Slaw & Salsa Verde

Panko-crusted white fish tacos with tangy lime slaw, salsa verde, and crema — ready in 15 minutes. A weeknight version of the Baja classic that tastes like a beachside stand.

Total time
15 min
Servings
2
Calories
420
Protein
28g
Crispy Fish Tacos with Slaw & Salsa Verde
casualsatisfyingmexicanfishcrispytenderweeknighttaco

Ingredients

  • ¾ lb white fish fillets (cod, halibut, or mahi)
  • ¾ cup panko breadcrumbs
  • 2 cups green cabbage, shredded
  • 1 whole lime (juiced)
  • 6 whole warm corn tortillas
  • ¾ cup combined salsa verde + sour cream

Instructions

  1. 1

    Pat fish dry with paper towels. Season both sides generously with salt and pepper.

  2. 2

    Spread panko on a plate. Press each fillet into panko, coating both sides evenly.

  3. 3

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  4. 4

    Fry fish 3 minutes per side without moving until golden and cooked through. Transfer to a plate.

  5. 5

    Toss shredded cabbage with lime juice and a pinch of salt until wilted slightly, about 2 minutes.

  6. 6

    Warm tortillas in the skillet 30 seconds per side. Flake fish, divide among tortillas, top with slaw, salsa, and crema. Serve immediately.

Tools you’ll need

  • 12-inch nonstick or cast iron skillet
  • paper towels
  • shallow plate
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.