CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Fish with Rice & Charred Greens

Whole fish fried until golden and crackling, served over jasmine rice with stir-fried water spinach, sambal heat, and crispy shallots. A complete Vietnamese dinner in under 30 minutes.

Total time
28 min
Servings
2
Calories
620
Protein
42g
Crispy Fish with Rice & Charred Greens
satisfyingcasualvietnamesefishcrispytenderweeknightdinner

Ingredients

  • 1.5 lb whole fish (sea bream, snapper, or tilapia), gutted and scaled
  • 4 cups water spinach (or spinach), cut into 2-inch pieces
  • 1 cup bean sprouts
  • 3 tbsp sambal oelek (or chili paste)
  • 3 tbsp fried shallots
  • 2 cups jasmine rice, cooked
  • 2 tbsp fish sauce
  • 1 cup neutral oil for frying

Instructions

  1. 1

    Pat fish dry inside and out with paper towels. Make 2–3 diagonal slashes on each side.

  2. 2

    Heat neutral oil in a large deep skillet to 350°F (a pinch of flour sizzles immediately).

  3. 3

    Slide fish into hot oil. Fry 6–7 minutes per side without moving until skin is mahogany-brown and crackling.

  4. 4

    Transfer fish to a paper-towel-lined plate. Pour off all but 2 tbsp oil into a bowl.

  5. 5

    In the same skillet, stir-fry water spinach and bean sprouts 2 minutes over high heat until wilted but still bright.

  6. 6

    Divide rice onto plates, top with fish, greens, and sambal. Drizzle 1 tbsp fish sauce over rice and finish with fried shallots.

Tools you’ll need

  • large deep skillet (10–12 inch)
  • paper towels
  • instant-read thermometer or wooden spoon for oil test
  • slotted spatula
  • plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.