CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Egg Bibimbap Bowl

Warm rice topped with quick-sautéed vegetables, a fried egg, and gochujang-sesame sauce. Everything cooks in one skillet in under 25 minutes — no special equipment needed.

Total time
24 min
Servings
2
Calories
485
Protein
14g
Crispy Egg Bibimbap Bowl
satisfyingquickkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups cooked rice (white or brown)
  • 3 tbsp gochujang (Korean red chili paste)
  • 2 tbsp sesame oil
  • 1 medium zucchini
  • 4 oz shiitake mushrooms
  • 2 cups spinach (fresh)
  • 1 large carrots
  • 2 whole eggs

Instructions

  1. 1

    Whisk gochujang with 1 tbsp sesame oil, 1 tbsp soy sauce, and 1 tsp sugar until smooth.

  2. 2

    Slice zucchini into half-moons, thinly slice mushrooms, and cut carrots into matchsticks.

  3. 3

    Heat 1 tbsp sesame oil in a large skillet over medium-high. Sauté zucchini and mushrooms until golden, ~4 minutes. Transfer to a plate.

  4. 4

    Add carrots to the same skillet, cook 2 minutes, then add spinach and wilt for 30 seconds.

  5. 5

    Push vegetables to the edge of the skillet. Crack eggs into the center and fry until whites set but yolks still jiggle, ~3 minutes.

  6. 6

    Divide rice between bowls. Top each with cooked vegetables and one fried egg. Drizzle generously with gochujang sauce and serve hot.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board
  • knife
  • small bowl
  • whisk
  • wooden spoon
  • serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.