CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Curry Puff Skillet

Flaky phyllo parcels stuffed with spiced chicken and potato, pan-fried until golden. A Malaysian-inspired weeknight dinner that tastes like street food but comes together in 15 minutes.

Total time
15 min
Servings
2
Calories
385
Protein
18g
Crispy Curry Puff Skillet
comfortcasualmalaysianchickencrispyflakyweeknightappetizer

Ingredients

  • 1 cup rotisserie chicken, shredded
  • ½ cup potato, finely diced
  • 1.5 tbsp curry powder
  • 8 sheets phyllo sheets
  • ¼ cup onion, minced
  • 3 tbsp coconut milk
  • 3 tbsp neutral cooking oil
  • ½ whole lime

Instructions

  1. 1

    Mix shredded chicken, diced potato, minced onion, curry powder, and coconut milk in a bowl until combined.

  2. 2

    Brush one phyllo sheet lightly with oil, place 2 tbsp filling in the corner, fold into a tight triangle, then brush the outside with oil.

  3. 3

    Repeat with remaining phyllo sheets and filling to make 4 parcels total.

  4. 4

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  5. 5

    Fry parcels 2–3 minutes per side until deep golden and edges curl. Don't move them while they crisp.

  6. 6

    Serve hot with lime wedges squeezed over the top.

Tools you’ll need

  • mixing bowl
  • 12-inch skillet
  • pastry brush
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.