CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Clam Cakes

Tender, golden clam cakes with a crispy exterior and briny, sweet clam filling. Pan-fried in under 20 minutes — a New England classic that tastes fried but isn't.

Total time
18 min
Servings
12
Calories
145
Protein
6g
Crispy Clam Cakes
casualcomfortamericanclamscrispytenderweeknightappetizer

Ingredients

  • 2 cans (6.5 oz each) canned clams with juice
  • 1 cup all-purpose flour
  • ½ cup cornmeal
  • 1 large egg
  • 1 tsp baking powder
  • ½ cup oyster crackers, crushed

Instructions

  1. 1

    Drain clams, reserving 3 tbsp juice. Chop clams finely.

  2. 2

    Mix flour, cornmeal, baking powder, and salt in a bowl. Whisk egg with reserved clam juice, then stir into dry mixture until just combined.

  3. 3

    Fold in chopped clams and crushed oyster crackers until evenly distributed.

  4. 4

    Heat 0.5 inch oil in a 12-inch skillet over medium-high until surface shimmers, about 2 minutes.

  5. 5

    Drop batter by rounded tbsp into hot oil. Fry 2 minutes per side until deep golden brown and edges curl slightly.

  6. 6

    Transfer to a paper-towel-lined plate. Serve warm, optionally with hot sauce or tartar sauce.

Tools you’ll need

  • 12-inch skillet
  • mixing bowl
  • whisk
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.