CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Chili Liver & Rice with Duck Egg

Tender chicken liver seared in a fiery sambal glaze, plated with jasmine rice, a runny duck egg, and quick stir-fried shrimp vegetables. A complete Indonesian dinner in under 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
38g
Crispy Chili Liver & Rice with Duck Egg
satisfyingboldindonesianchickencrispytendercreamyweeknight

Ingredients

  • 10 oz chicken liver, cut into bite-sized pieces
  • 3 tbsp sambal oelek or chili paste
  • 2 medium shallots, sliced thin
  • 6 oz shrimp, peeled and deveined
  • 1.5 cups mixed vegetables (snap peas, carrots, green beans)
  • 2 whole salted duck eggs
  • 1.5 cups cooked jasmine rice, warm

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high. Pat liver dry, season with salt and pepper.

  2. 2

    Sear liver 2–3 minutes per side without moving — edges should caramelize. Transfer to a plate.

  3. 3

    Add shallots to the same pan, cook 90 seconds until fragrant. Stir in sambal and cook 60 seconds more.

  4. 4

    Add shrimp and vegetables. Stir-fry 3–4 minutes until shrimp turn pink and vegetables soften slightly.

  5. 5

    Return liver to the pan, toss gently to coat in sambal. Cook 1 minute more until warmed through.

  6. 6

    Divide rice between bowls. Top with liver mixture, set a duck egg alongside, and serve hot.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • cutting board
  • chef's knife
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.