CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Chilaquiles Verdes with Chicken

Fried tortilla chips tossed in tangy green salsa with shredded chicken and topped with melted cheese. A one-pan Mexican breakfast that's ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
445
Protein
28g
Crispy Chilaquiles Verdes with Chicken
comfortcasualmexicanchickencrispytendermeltyweeknight

Ingredients

  • 1.5 cups cooked chicken, shredded
  • 1.5 cups salsa verde (fresh or jarred)
  • 3 cups tortilla chips (unflavored)
  • ¾ cup shredded Oaxaca or mozzarella cheese
  • 2 tablespoons olive oil
  • 0 to taste salt and pepper

Instructions

  1. 1

    Pour 2 tablespoons olive oil into a 10-inch skillet and place it over medium-high heat for 60 seconds until the oil shimmers and slides quickly when you tilt the pan.

  2. 2

    Add 3 cups tortilla chips to the hot oil and stir constantly for 90 seconds until the chips darken slightly and smell toasted, so they stay crispy instead of becoming soggy.

  3. 3

    Pour 1.5 cups salsa verde into the skillet and stir everything together for 30 seconds until the chips are evenly coated with green sauce.

  4. 4

    Add 1.5 cups shredded cooked chicken to the skillet and stir for 60 seconds until the chicken is warmed through and mixed with the chips and sauce.

  5. 5

    Sprinkle 0.75 cup shredded Oaxaca cheese evenly over the top of the mixture in the skillet.

  6. 6

    Cover the skillet with a lid or a baking sheet and reduce heat to medium for 120 seconds until the cheese melts completely and looks glossy.

  7. 7

    Remove the skillet from heat, taste the chilaquiles, and sprinkle with salt and pepper as needed.

  8. 8

    Scoop the chilaquiles into two bowls using a spatula, scraping all the sauce from the bottom of the skillet so nothing is left behind.

Tools you’ll need

  • 10-inch skillet with lid or baking sheet
  • spatula
  • spoon for stirring
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.