CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Chicken Satay

Juicy chicken thighs roasted until edges crisp, paired with a silky peanut sauce spiked with lime and garlic. One sheet pan, zero fuss.

Total time
18 min
Servings
4
Calories
420
Protein
38g
Crispy Chicken Satay
satisfyingcasualthaichickencrispytendercreamyweeknight

Ingredients

  • 1.5 lbs boneless chicken thighs
  • ½ cup natural peanut butter (no sugar added)
  • 3 tbsp soy sauce
  • 1 whole lime (juiced + zested)
  • 3 whole garlic cloves (minced)
  • 1 tbsp sriracha or chili paste

Instructions

  1. 1

    Pat chicken dry. Toss with 1 tbsp oil, salt, and pepper. Spread on a sheet pan in a single layer.

  2. 2

    Roast at 425°F until edges brown and a thermometer reads 165°F at the thickest point, 12–14 minutes.

  3. 3

    While chicken cooks, whisk peanut butter, soy sauce, lime juice and zest, garlic, and sriracha in a small bowl until smooth.

  4. 4

    If sauce is thick, thin it with 2–3 tbsp water until it reaches a drizzle consistency.

  5. 5

    Drizzle sauce over hot chicken. Serve immediately with lime wedges and cilantro if you have it.

Tools you’ll need

  • sheet pan
  • measuring cups and spoons
  • paper towels
  • small bowl and whisk
  • meat thermometer
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.