CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Chicken Pecel Lele

Pan-fried chicken thighs with Indonesian peanut-chili sauce, served over crispy fried shallots and steamed rice. Bold, spicy, and ready in 20 minutes.

Total time
20 min
Servings
4
Calories
520
Protein
38g
Crispy Chicken Pecel Lele
satisfyingboldindonesianchickencrispytenderweeknightmain-dish

Ingredients

  • 1.5 lbs boneless, skinless chicken thighs
  • ⅓ cup creamy peanut butter
  • 2 tbsp sambal oelek (chili paste)
  • 1 whole lime (juiced)
  • ½ cup fried shallots (crispy)
  • 2 cups cooked jasmine rice

Instructions

  1. 1

    Pat chicken thighs dry. Season both sides generously with salt and pepper.

  2. 2

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering, about 90 seconds.

  3. 3

    Sear chicken 5–6 minutes per side without moving until golden brown and cooked through.

  4. 4

    Stir peanut butter, sambal oelek, lime juice, and 0.25 cup water in a bowl until smooth.

  5. 5

    Pour sauce over chicken. Toss to coat, then simmer for 2 minutes until sauce coats the meat.

  6. 6

    Plate rice, top with chicken and sauce, then scatter fried shallots over the top.

Tools you’ll need

  • 12-inch skillet
  • small mixing bowl
  • spoon or tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.