CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Chicken Coconut Curry Bowl

Crispy pan-fried chicken over jasmine rice with a creamy coconut curry sauce, topped with broccoli, carrots, chickpeas, and fresh microgreens. Built in one skillet, ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
624
Protein
42g
Crispy Chicken Coconut Curry Bowl
satisfyingcomfortthaichickencrispytendercreamyweeknight

Ingredients

  • 1 lb boneless, skinless chicken breasts
  • 3 tbsp coconut curry paste (red or green)
  • 1 can (13.5 oz) coconut milk
  • 1 cup jasmine rice (uncooked)
  • 2 cups broccoli and carrots (fresh or frozen)
  • ¾ cup canned chickpeas, drained
  • ½ cup fresh microgreens or cilantro

Instructions

  1. 1

    Start jasmine rice in a pot with 2 cups water. Bring to boil, then reduce heat and cover for 15 minutes until tender.

  2. 2

    While rice cooks, cut chicken breasts into 1-inch pieces. Heat oil in a 12-inch skillet over medium-high until shimmering.

  3. 3

    Add chicken to skillet and cook without stirring for 3 minutes until golden, then stir and cook 3 minutes more until cooked through.

  4. 4

    Stir in curry paste and cook for 1 minute until fragrant, then pour in coconut milk and stir until smooth.

  5. 5

    Add broccoli, carrots, and chickpeas. Simmer for 4 minutes until vegetables are tender but still bright.

  6. 6

    Divide rice between bowls, top with curry chicken and vegetables, then scatter microgreens over and serve immediately.

Tools you’ll need

  • 12-inch skillet with lid (or foil to cover)
  • medium pot with lid
  • wooden spoon or spatula
  • measuring cups and spoons
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.