CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Chicken Caesar Wrap

Golden tortilla stuffed with crispy chicken, romaine, and creamy Caesar dressing—ready in 15 minutes. Serve with fries and your favorite dipping sauce on the side.

Total time
15 min
Servings
2
Calories
520
Protein
38g
Crispy Chicken Caesar Wrap
casualquickamericanchickencrispytenderweeknightlunch

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • 2 count large flour tortillas
  • 2 cups romaine lettuce, chopped
  • ½ cup caesar dressing
  • ¼ cup parmesan cheese, shredded
  • 1 tbsp butter

Instructions

  1. 1

    Heat butter in a large skillet over medium-high heat until it foams, about 1 minute.

  2. 2

    Place a tortilla in the skillet and cook for 90 seconds per side until golden and crispy.

  3. 3

    Transfer to a plate. Repeat with the second tortilla, then set both aside to cool slightly.

  4. 4

    Toss shredded chicken with half the caesar dressing until coated.

  5. 5

    Lay a tortilla flat. Layer romaine, dressed chicken, and parmesan down the center.

  6. 6

    Drizzle with remaining dressing. Roll tightly, slice in half, and serve immediately.

Tools you’ll need

  • large skillet
  • cutting board
  • bowl
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.