CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Crispy Chicken Bastilla

Phyllo-wrapped chicken with warm spices, honey, and a dusting of powdered sugar — the sweet-savory magic of Morocco in a weeknight pan. Crispy, fragrant, and ready in 20 minutes.

Total time
20 min
Servings
2
Calories
468
Protein
32g
20-Min Crispy Chicken Bastilla
elegantcozymoroccanchickencrispytenderflakyweeknight

Ingredients

  • 2 cups rotisserie chicken, shredded
  • 4 sheets phyllo dough sheets
  • ½ medium onion, finely diced
  • 2 tbsp honey
  • 1 tsp garam masala or ras el hanout spice blend
  • 1 tbsp powdered sugar

Instructions

  1. 1

    Heat 2 tbsp oil in a medium skillet over medium-high. Add diced onion, cook until soft, ~3 minutes.

  2. 2

    Stir in shredded chicken, honey, and spice blend. Cook until fragrant and warmed through, ~2 minutes.

  3. 3

    Lay one phyllo sheet flat. Brush lightly with oil. Layer a second sheet on top, brush again.

  4. 4

    Spread half the chicken mixture down the center. Fold sides in, then roll tightly like a burrito.

  5. 5

    Repeat with remaining phyllo sheets and chicken. Pan-fry both rolls seam-side down until golden, ~2 min per side.

  6. 6

    Transfer to a plate. Dust generously with powdered sugar and serve hot.

Tools you’ll need

  • medium skillet (10-inch)
  • wooden spoon or spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.