Crispy Chicken Banh Mi
Shredded rotisserie chicken tossed with tangy pickled veggies and mayo, piled onto a crusty baguette with cilantro and jalapeño. Ready in 15 minutes, tastes like you ordered it from a corner stall in Hanoi.
- Total time
- 15 min
- Servings
- 2
- Calories
- 485
- Protein
- 32g
casualfreshvietnamesechickencrispytendercrunchyweeknight
Ingredients
- 1.5 cups rotisserie chicken, shredded
- 1 whole (6-inch) baguette, crusty
- ¾ cup pickled vegetables (carrots, daikon, cucumber)
- 3 tbsp mayonnaise
- ¼ cup fresh cilantro, chopped
- ½ whole jalapeño, sliced thin
- ½ whole lime
Instructions
- 1
Slice the baguette in half lengthwise. Spread mayo inside both halves evenly.
- 2
Toss shredded chicken with a squeeze of lime juice and a pinch of salt.
- 3
Layer chicken on the bottom half, then pile pickled veggies on top.
- 4
Top with fresh cilantro and jalapeño slices, then close with the top half.
- 5
Press down gently, cut in half, and serve immediately with a cold beer.
Tools you’ll need
- serrated knife
- cutting board
- small bowl
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
