Crispy Cheese Tart with Tomatoes & Olives
A Swiss-style cheese tart with a crispy pastry base, melted cheese filling, and bright fresh toppings. Ready in 20 minutes for a weeknight dinner that tastes fancy.
- Total time
- 20 min
- Servings
- 2
- Calories
- 528
- Protein
- 18g
comfortsimpleswissvegetariancheesecrispymeltytender
Ingredients
- 1 sheet (about 8 oz) puff pastry sheet, thawed
- 1.5 cups Gruyère or Emmental cheese, shredded
- 1 cup cherry tomatoes, halved
- ½ cup green olives, pitted
- 1 whole egg, beaten
- 1 tbsp fresh thyme or chives, chopped
Instructions
- 1
Preheat oven to 400°F. Line a sheet pan with parchment and lay out the thawed puff pastry.
- 2
Brush the pastry edges with beaten egg for a golden finish.
- 3
Spread shredded cheese evenly over the pastry, leaving a 0.5-inch border.
- 4
Scatter tomato halves and olives across the cheese in an even layer.
- 5
Bake 12–14 minutes until the pastry is golden brown and crispy at the edges.
- 6
Remove from oven, sprinkle with fresh thyme, slice into 4 pieces, and serve hot.
Tools you’ll need
- sheet pan
- parchment paper
- pastry brush
- chef's knife
- cutting board
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
