CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Cheese Tart with Tomatoes & Olives

A Swiss-style cheese tart with a crispy pastry base, melted cheese filling, and bright fresh toppings. Ready in 20 minutes for a weeknight dinner that tastes fancy.

Total time
20 min
Servings
2
Calories
528
Protein
18g
Crispy Cheese Tart with Tomatoes & Olives
comfortsimpleswissvegetariancheesecrispymeltytender

Ingredients

  • 1 sheet (about 8 oz) puff pastry sheet, thawed
  • 1.5 cups Gruyère or Emmental cheese, shredded
  • 1 cup cherry tomatoes, halved
  • ½ cup green olives, pitted
  • 1 whole egg, beaten
  • 1 tbsp fresh thyme or chives, chopped

Instructions

  1. 1

    Preheat oven to 400°F. Line a sheet pan with parchment and lay out the thawed puff pastry.

  2. 2

    Brush the pastry edges with beaten egg for a golden finish.

  3. 3

    Spread shredded cheese evenly over the pastry, leaving a 0.5-inch border.

  4. 4

    Scatter tomato halves and olives across the cheese in an even layer.

  5. 5

    Bake 12–14 minutes until the pastry is golden brown and crispy at the edges.

  6. 6

    Remove from oven, sprinkle with fresh thyme, slice into 4 pieces, and serve hot.

Tools you’ll need

  • sheet pan
  • parchment paper
  • pastry brush
  • chef's knife
  • cutting board
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.