Crispy Cheese Quesadilla Triangles
Melted cheddar tucked into tortilla triangles, pan-fried until golden and crispy. Serve with salsa, guac, and fresh veggies for dipping.
- Total time
- 10 min
- Servings
- 2
- Calories
- 340
- Protein
- 12g
quickcasualamericanvegetariancheesecrispymeltysnack
Ingredients
- 2 large (10-inch) flour tortillas
- 1 cup cheddar cheese, shredded
- ½ cup salsa
Instructions
- 1
Lay one tortilla flat and scatter half the cheddar over one half of the disk.
- 2
Fold the tortilla in half, then cut into two triangles.
- 3
Repeat with the second tortilla and remaining cheese to make 4 triangles total.
- 4
Heat oil in a skillet over medium-high until shimmering, about 60 seconds.
- 5
Pan-fry triangles 2–3 minutes per side until cheese melts and tortilla turns golden.
- 6
Serve hot with salsa, guacamole, and fresh peppers and tomatoes for dipping.
Tools you’ll need
- cutting board
- knife
- 12-inch skillet
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
