CookSnap is coming soon — Join the waitlist →

Crispy Cheese Quesadilla

Melted cheese tucked between crispy tortillas, ready in under 10 minutes. Perfect for a quick snack or light lunch.

Total time
8 min
Servings
2
Calories
380
Protein
12g
Crispy Cheese Quesadilla
quickcasualmexicanvegetariancheesecrispymeltyweeknight

Ingredients

  • 4 count flour tortillas (8-inch)
  • 1.5 cups shredded cheese (cheddar, Oaxaca, or Monterey Jack)
  • 1 tbsp butter
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Heat a 10-inch skillet over medium-high heat until a drop of water sizzles on contact, ~90 seconds.

  2. 2

    Rub one side of a tortilla with half the butter, then place butter-side down in the skillet.

  3. 3

    Sprinkle 1/3 cup cheese evenly over the tortilla, then top with a second tortilla.

  4. 4

    Rub the top tortilla with remaining butter, then press gently with a spatula.

  5. 5

    Cook 2–3 minutes without moving until the bottom is golden and crispy.

  6. 6

    Flip and cook the other side 2 minutes until golden and cheese melts completely.

  7. 7

    Transfer to a cutting board and repeat with remaining tortillas and cheese.

  8. 8

    Cut each quesadilla into 4 wedges and serve immediately.

Tools you’ll need

  • 10-inch skillet (cast iron or non-stick)
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.