CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Cheese Puff Pastry Bake

Swiss chäschüechli reimagined as a 15-minute sheet-pan bake: puff pastry squares topped with melted Gruyère, sharp mustard, and a crack of pepper. Golden, gooey, and dangerously easy.

Total time
15 min
Servings
4
Calories
385
Protein
12g
Crispy Cheese Puff Pastry Bake
indulgentquickswissvegetariancheesecrispyflakygooey

Ingredients

  • 1 sheet (9 oz), thawed 15 minutes frozen puff pastry sheets
  • 1.5 cups Gruyère cheese, shredded
  • 3 tbsp whole grain mustard
  • ½ tsp black pepper, freshly cracked
  • ¼ tsp sea salt
  • 1 large egg (for egg wash)

Instructions

  1. 1

    Preheat oven to 400°F. Line a sheet pan with parchment paper.

  2. 2

    Cut thawed pastry into 16 squares. Arrange on the sheet pan, spacing 1 inch apart.

  3. 3

    Brush each square lightly with egg wash. Top with 1.5 tbsp Gruyère and 0.5 tsp mustard per square.

  4. 4

    Sprinkle with black pepper and salt. Bake 10-12 minutes until pastry is puffed and golden.

  5. 5

    Cool 2 minutes on the pan. Serve hot, cheese still melting.

Tools you’ll need

  • sheet pan
  • parchment paper
  • knife
  • small bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.