CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Cheese & Herb Sigara Borek

Thin phyllo pastry rolled with salty feta and fresh herbs, pan-fried until golden and crispy. A classic Turkish breakfast that's ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
11g
Crispy Cheese & Herb Sigara Borek
simplecrispyturkishvegetariancheesecrispyflakybreakfast

Ingredients

  • 8 sheets phyllo dough (thawed if frozen)
  • ¾ cup feta cheese, crumbled
  • ¼ cup fresh parsley, finely chopped
  • 2 tbsp fresh dill, finely chopped
  • 4 tbsp butter, melted
  • ¼ tsp black pepper

Instructions

  1. 1

    Mix feta, parsley, dill, and black pepper in a small bowl until combined.

  2. 2

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter.

  3. 3

    Place 2 tbsp filling 1 inch from the bottom edge, leaving 1 inch on each side.

  4. 4

    Fold the left and right edges inward to cover 1 inch of filling on each side.

  5. 5

    Roll tightly away from you into a cigar shape. Repeat with remaining phyllo.

  6. 6

    Heat 2 tbsp butter in a large skillet over medium-high until it foams.

  7. 7

    Pan-fry 4 borek 3 minutes per side until golden brown and crispy, then set aside.

  8. 8

    Add remaining 2 tbsp butter and pan-fry the final 4 borek 3 minutes per side.

  9. 9

    Serve warm with a squeeze of lemon juice if desired.

Tools you’ll need

  • cutting board
  • small mixing bowl
  • 12-inch skillet
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.