CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Cheese Ball with Dipping Sauces

A Swiss classic—deep-fried cheese and ham nestled in potato, golden and crispy outside, molten inside. Serve with sweet chili and tartar sauce for the ultimate TikTok-worthy finger food.

Total time
20 min
Servings
2
Calories
520
Protein
18g
Crispy Cheese Ball with Dipping Sauces
indulgentfunswissvegetariancheesecrispycreamymelty

Ingredients

  • 200 g Gruyère or Emmental cheese, cubed
  • ½ cup all-purpose flour
  • 2 whole eggs
  • 1 cup mashed potatoes (instant or leftover)
  • 3 cups neutral oil for frying
  • ½ cup total sweet chili sauce + tartar sauce for serving

Instructions

  1. 1

    Set up three shallow bowls: flour in the first, beaten eggs in the second, mashed potatoes in the third.

  2. 2

    Toss cheese cubes in flour to coat lightly, shaking off excess.

  3. 3

    Dip each floured cube into egg, then press firmly into mashed potatoes until fully coated.

  4. 4

    Heat oil in a heavy pot to 350°F (175°C)—a cube of bread should brown in 60 seconds.

  5. 5

    Fry the balls 2–3 minutes until deep golden, turning occasionally so they cook evenly.

  6. 6

    Drain on paper towels. Serve immediately with sweet chili and tartar sauce.

Tools you’ll need

  • three shallow bowls
  • heavy pot or Dutch oven
  • instant-read thermometer
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.