CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy California Veggie Burger

Pan-fried chickpea patties with avocado, tomato, and sprouts on a toasted bun. Ready in 15 minutes—crispy outside, creamy inside.

Total time
15 min
Servings
2
Calories
385
Protein
14g
Crispy California Veggie Burger
casualquickcalifornianvegetarianchickpeascrispycreamyweeknight

Ingredients

  • 1 can (15 oz) canned chickpeas, drained and patted dry
  • ⅓ cup panko breadcrumbs
  • 1 whole avocado, ripe
  • 1 medium tomato, sliced
  • 2 whole hamburger buns
  • 1 cup fresh sprouts (alfalfa or sunflower)
  • ½ whole lime (juiced)

Instructions

  1. 1

    Mash chickpeas with a fork until broken but still chunky. Stir in breadcrumbs, salt, and pepper.

  2. 2

    Form into two patties, about 3.5 inches wide and 3/4 inch thick.

  3. 3

    Heat oil in a skillet over medium-high until it shimmers. Pan-fry patties 4 minutes per side until golden and crispy.

  4. 4

    Toast buns cut-side down in the same skillet for 90 seconds until light golden.

  5. 5

    Mash avocado with lime juice, salt, and pepper. Spread on bottom buns.

  6. 6

    Layer patty, tomato slices, sprouts, and top bun. Serve immediately.

Tools you’ll need

  • medium bowl
  • fork
  • 10-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.