CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Braciole with Marinara

Thin beef cutlets stuffed with Italian herbs and breadcrumbs, seared crispy, then finished in marinara sauce. A TikTok-easy riff on the classic Italian roll that's done in 20 minutes, not hours.

Total time
20 min
Servings
2
Calories
285
Protein
22g
Crispy Braciole with Marinara
comfortelegantitalianbeeftendercrispyweeknightdate-night

Ingredients

  • 4 ounces beef cutlets (thin-sliced, pounded if thick)
  • 3 tbsp panko breadcrumbs
  • 2 tbsp grated Pecorino Romano
  • 2 tbsp fresh parsley (chopped)
  • 1 cup marinara sauce
  • ¼ tsp pinch red pepper flakes
  • 1 tbsp olive oil
  • 3 leaves fresh basil leaves

Instructions

  1. 1

    Mix panko, Pecorino, parsley, and red pepper flakes in a small bowl.

  2. 2

    Lay cutlets on a cutting board, divide filling evenly, and roll tightly from the short end.

  3. 3

    Heat oil in a 10-inch skillet over medium-high until shimmering, about 60 seconds.

  4. 4

    Sear each braciole 90 seconds per side without moving, until golden brown.

  5. 5

    Pour marinara around the braciole, reduce heat to medium, and simmer 6–8 minutes covered.

  6. 6

    Tear basil over the top and serve immediately with crusty bread.

Tools you’ll need

  • 10-inch skillet
  • small bowl
  • cutting board
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.