CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Beef Milanesa

Thin-pounded beef cutlets breaded and pan-fried until golden and crackling. Serve with lemon, fresh salad, or chimichurri for an instant weeknight dinner that tastes like a Buenos Aires kitchen.

Total time
20 min
Servings
2
Calories
520
Protein
38g
Crispy Beef Milanesa
casualsatisfyingargentinianbeefcrispytenderweeknightmain-dish

Ingredients

  • ¾ lb beef sirloin or round steak, thin-cut (or ask butcher to pound)
  • ½ cup all-purpose flour
  • 1 whole egg
  • ¾ cup panko breadcrumbs
  • 1 whole lemon
  • 3 tbsp neutral cooking oil (vegetable or canola)

Instructions

  1. 1

    If not pre-pounded, lay beef between plastic wrap and pound to 1/8-inch thick using a meat mallet.

  2. 2

    Pat dry with paper towels. Season both sides generously with salt and black pepper.

  3. 3

    Set up three shallow bowls: flour, beaten egg, and panko. Dredge each cutlet in flour, tap off excess, dip in egg, then coat evenly with panko.

  4. 4

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  5. 5

    Fry breaded cutlets 2–3 minutes per side without moving until golden brown and crisp. Work in batches if needed.

  6. 6

    Transfer to a plate. Squeeze fresh lemon over the top and serve hot.

Tools you’ll need

  • meat mallet
  • paper towels
  • three shallow bowls
  • 12-inch skillet
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.