CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Beef & Garlic Stir-Fry

Tender beef strips tossed with crispy garlic chips and a savory soy-vinegar glaze, finished with fresh herbs. The Vietnamese classic, ready in 15 minutes flat.

Total time
15 min
Servings
2
Calories
385
Protein
36g
Crispy Beef & Garlic Stir-Fry
quicksatisfyingvietnamesebeefcrispytenderweeknightstir-fry

Ingredients

  • ¾ lb beef sirloin or ribeye, sliced thin against the grain
  • 8 cloves garlic cloves, sliced thin
  • 3 tbsp soy sauce
  • 1 tbsp white vinegar
  • 3 tbsp neutral oil
  • ¼ cup fresh cilantro and scallion, chopped

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Add garlic slices and cook, stirring constantly, until golden and crispy, 2–3 minutes. Transfer to a plate.

  3. 3

    Add remaining 2 tbsp oil to the skillet and increase heat to high. Working in two batches, sear beef 90 seconds per side without stirring — edges should brown deeply.

  4. 4

    Return all beef to the skillet. Add soy sauce and vinegar, toss for 30 seconds until the surface glistens.

  5. 5

    Top with crispy garlic, cilantro, and scallion. Serve immediately over rice or with lettuce wraps.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.