CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Beef Croquettes (15-Min Kroketten)

Dutch-style beef croquettes with a golden panko crust and creamy beef interior, ready in 10 minutes using pre-cooked rotisserie beef or leftover roast. Serve with mustard for dipping.

Total time
15 min
Servings
2
Calories
385
Protein
22g
Crispy Beef Croquettes (15-Min Kroketten)
comfortcasualdutchbeefcrispycreamyweeknightdinner

Ingredients

  • 1 cup cooked beef (rotisserie or leftover roast), finely shredded
  • 2 tbsp butter
  • 2 tbsp all-purpose flour
  • ½ cup whole milk
  • ½ cup panko breadcrumbs
  • 3 tbsp dijon mustard (for serving)

Instructions

  1. 1

    Melt butter in a small saucepan over medium heat. Add flour, stir constantly for 1 minute until light golden.

  2. 2

    Whisk in milk slowly until no lumps remain. Add shredded beef, salt, and pepper. Stir until thick paste forms, ~2 minutes.

  3. 3

    Spread beef mixture on a plate and refrigerate while you prepare to fry, about 3 minutes.

  4. 4

    Shape mixture into 4 logs (about 3 inches long). Roll each in panko until fully coated.

  5. 5

    Heat oil in a large skillet over medium-high until shimmering. Fry croquettes 90 seconds per side until deep golden brown.

  6. 6

    Serve hot with dijon mustard for dipping.

Tools you’ll need

  • small saucepan
  • whisk
  • plate
  • large skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.