CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Crispy Apple Pie Skillet

Buttery phyllo sheets layered with cinnamon apples and baked until golden—a 15-minute take on Polish szarlotka that skips the lattice. Serve warm with a scoop of vanilla ice cream.

Total time
20 min
Servings
4
Calories
285
Protein
3g
20-Min Crispy Apple Pie Skillet
comfortcozypolishvegetariancrispytenderweeknightdessert

Ingredients

  • 6 sheets phyllo dough, thawed
  • 4 tbsp butter, melted
  • 4 medium apples, peeled and sliced thin
  • 3 tbsp granulated sugar
  • 1 tsp ground cinnamon
  • 1 tbsp lemon juice

Instructions

  1. 1

    Toss apple slices with sugar, cinnamon, and lemon juice in a bowl until coated.

  2. 2

    Brush a 10-inch skillet with melted butter, then layer 3 phyllo sheets, brushing each with butter as you go.

  3. 3

    Spread apple mixture evenly over the phyllo base, then top with remaining 3 sheets, brushing each with butter.

  4. 4

    Score the top phyllo into 4 wedges with a knife, cutting partway through without cutting to the bottom.

  5. 5

    Bake at 400°F until the phyllo is golden brown and crispy, about 12 minutes.

  6. 6

    Cool for 2 minutes, then slide onto a cutting board and cut along the score lines. Serve warm.

Tools you’ll need

  • 10-inch cast iron or non-stick skillet
  • medium mixing bowl
  • sharp knife
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.