Crispy Air Fryer Mozzarella Sticks
Golden, melty mozzarella sticks with a crispy panko crust in 10 minutes, zero fuss. Dip in marinara and watch them disappear.
- Total time
- 10 min
- Servings
- 2
- Calories
- 280
- Protein
- 16g
casualsatisfyingitalianvegetariancheesecrispymeltysnack
Ingredients
- 12 pieces mozzarella sticks, frozen
- ½ cup panko breadcrumbs
- ¾ cup marinara sauce
- 2 tbsp cooking spray
Instructions
- 1
Coat the basket of your air fryer with cooking spray.
- 2
Toss frozen mozzarella sticks with panko until evenly coated.
- 3
Arrange sticks in the basket in a single layer, spray lightly with cooking spray.
- 4
Air fry at 380°F for 8 minutes until golden and crispy outside.
- 5
Warm marinara in a small bowl or saucepan, about 1 minute.
- 6
Serve sticks immediately with warm marinara for dipping.
Tools you’ll need
- air fryer
- small bowl
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
