CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Saffron Panna Cotta with Pistachio Garnish

Silky saffron-infused panna cotta inspired by Indian flavors, topped with crushed pistachios. A elegant, melt-in-your-mouth dessert that bridges Italian technique with Indian spice.

Total time
240 min
Servings
4
Calories
385
Protein
6g
Creamy Saffron Panna Cotta with Pistachio Garnish
Indiandessertindiangluten-freeelegantmake-aheadcreamyvegetarian

Ingredients

  • 1.5 cup heavy cream
  • ½ cup whole milk
  • ¼ tsp saffron threads
  • ¼ cup granulated sugar
  • 3 whole cardamom pods
  • ½ tsp vanilla extract
  • 2 tsp gelatin powder
  • 2 tbsp water
  • ½ tsp rose water
  • ¼ cup shelled pistachios

Instructions

  1. 1

    Bloom the gelatin by sprinkling it over 2 tbsp cold water in a small bowl; let it sit for 5 minutes until fully absorbed. Meanwhile, lightly crush the cardamom pods with the side of a knife to release their oils.

  2. 2

    Pour the heavy cream and whole milk into a heavy-bottomed saucepan. Add the crushed cardamom pods and saffron threads, then place over medium heat. Warm gently, stirring occasionally, until small bubbles form around the edge—about 5-7 minutes; do not boil.

  3. 3

    Remove from heat and stir in the granulated sugar until fully dissolved, about 1 minute. Add the vanilla extract and rose water, then strain the mixture through a fine-mesh sieve into a clean bowl, discarding the cardamom pods and saffron threads.

  4. 4

    Add the bloomed gelatin to the warm saffron cream while stirring constantly until the gelatin dissolves completely, about 1-2 minutes. The residual heat should melt it smoothly without any lumps.

  5. 5

    Divide the mixture evenly among four 4-oz ramekins or small serving glasses. Refrigerate for at least 4 hours, or up to 24 hours, until the panna cotta is set and trembles slightly when gently shaken but does not jiggle.

  6. 6

    Just before serving, finely chop or crush the shelled pistachios to a coarse texture. Sprinkle about 1 tbsp of crushed pistachios over the top of each chilled panna cotta, and serve immediately.

Tools you’ll need

  • Heavy-bottomed saucepan
  • Fine-mesh sieve
  • Small bowl
  • Whisk
  • Ramekins or serving glasses (4-oz)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.