CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Creamy Mussels in 15 Minutes

Fresh mussels steamed in a silky white wine and cream sauce with shallots and garlic. Belgian-style comfort that feels fancy but comes together in one pot.

Total time
15 min
Servings
2
Calories
385
Protein
28g
Creamy Mussels in 15 Minutes
elegantindulgentbelgianshrimptendercreamyweeknightdate-night

Ingredients

  • 2 lbs mussels, cleaned and debearded
  • 1 whole shallot, minced
  • ¾ cup dry white wine
  • ½ cup heavy cream
  • 2 tbsp fresh parsley (or dill), chopped
  • ½ whole lemon, halved

Instructions

  1. 1

    Heat 2 tbsp butter in a large pot over medium-high. Add shallot and cook 90 seconds until fragrant.

  2. 2

    Pour in white wine and bring to a simmer. Add mussels, cover, and steam 5-7 minutes until shells open.

  3. 3

    Remove mussels with a slotted spoon into bowls; discard any that didn't open. Stir cream into broth.

  4. 4

    Simmer sauce 2 minutes until slightly thickened. Squeeze lemon juice in and season with salt and pepper.

  5. 5

    Pour cream sauce over mussels. Garnish with parsley and serve immediately.

Tools you’ll need

  • 12-inch pot with lid
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.