CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Miso Ramen

A silky, umami-rich ramen with a miso-butter broth and chewy noodles. Topped with soft eggs, scallions, and crispy garlic for restaurant-quality comfort in one bowl.

Total time
35 min
Servings
2
Calories
520
Protein
14g
Creamy Miso Ramen
comfortcozyjapanesecreamytenderchewyweeknightcomfort-food-night

Ingredients

  • 6 cups vegetable broth
  • 3 tbsp white miso paste
  • 2 tbsp butter
  • 8 oz fresh ramen noodles
  • 2 whole eggs
  • 2 whole scallions, white and light green parts sliced thin
  • 2 cloves garlic cloves, minced
  • 2 tbsp olive oil
  • 1 pinch salt and black pepper

Instructions

  1. 1

    Bring a small pot of water to a boil. Add eggs and simmer 6 minutes for soft-cooked yolks.

  2. 2

    Transfer eggs to ice water to cool. Once cool, peel and halve them.

  3. 3

    Heat oil in a small skillet over medium. Add garlic and cook until fragrant, about 1 minute.

  4. 4

    Pour broth into a large pot and bring to a simmer over medium-high heat, about 5 minutes.

  5. 5

    Whisk miso and 2 tbsp broth together in a bowl until smooth, then stir into the pot.

  6. 6

    Stir in butter until melted and broth is creamy, about 1 minute.

  7. 7

    Add ramen noodles to the broth and cook until tender, 3–4 minutes, stirring occasionally.

  8. 8

    Divide noodles and broth between two bowls.

  9. 9

    Top each bowl with egg halves, scallions, crispy garlic, and a pinch of black pepper.

  10. 10

    Serve immediately.

Tools you’ll need

  • small pot
  • large pot
  • small skillet
  • whisk
  • bowls
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.