15-Min Creamy Egg Custard Cups
No-bake silky custard in espresso cups, ready in minutes. Sweetened condensed milk does the heavy lifting—just whisk, chill, and serve with espresso.
- Total time
- 15 min
- Servings
- 4
- Calories
- 248
- Protein
- 4g
elegantsimplechinesevegetarianeggssilkysmoothcreamy
Ingredients
- 3 large egg yolks
- ¾ cup sweetened condensed milk
- ½ cup evaporated milk
- ½ tsp vanilla extract
- ⅛ tsp salt
- 1 cup espresso (for serving)
Instructions
- 1
Whisk egg yolks, sweetened condensed milk, evaporated milk, vanilla, and salt until completely smooth and pale, about 2 minutes.
- 2
Pour custard mixture evenly into four small cups or ramekins, filling each halfway.
- 3
Chill for at least 10 minutes, or until set to a silky custard consistency.
- 4
Serve each custard cup alongside a shot of hot espresso for dipping or sipping.
Tools you’ll need
- whisk or fork
- bowl
- four small cups or espresso cups (3-4 oz)
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
